Everything below concerns Nicotinamide mononucleotide. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-06-18. Where a claim depends on a specific study, the study is described rather than over-claimed.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure consists of a nicotinamide ring linked to ribose phosphate, and the compound serves as an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+. In this pathway, nicotinamide phosphoribosyltransferase converts nicotinamide and phosphoribosyl pyrophosphate into NMN, after which NMN adenylyltransferase attaches an adenylate group to produce NAD+. Because NAD+ participates in redox reactions and signaling, NMN occupies a central position in cellular metabolism. The molecule is distinct from nicotinamide riboside, though the two are related in NAD+ precursor research.
Beyond its intracellular synthesis, NMN can be taken up from the extracellular environment, although the routes are still debated. Some evidence points to direct transport into cells through specific transporters, while other work suggests dephosphorylation to nicotinamide riboside followed by cellular uptake. Once inside, NMN can be converted to NAD+ by NMN adenylyltransferases; the relative contribution of these routes may differ by tissue, species, and experimental conditions. Researchers continue to investigate which mechanisms dominate in intact organisms and how they affect measured NAD+ levels. Direct measurement in tissues remains technically challenging because NMN can be rapidly metabolized during sample collection.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide found in the cells of many organisms. Its structure consists of a nicotinamide group linked to a ribose sugar that carries a phosphate group. NMN is an intermediate in the biosynthesis of nicotinamide adenine dinucleotide, or NAD+, a coenzyme involved in many metabolic reactions. The abbreviation usually refers to the beta anomer, though related forms can exist. In scientific literature, NMN is distinct from nicotinamide riboside, another NAD+ precursor.
In the NAD+ salvage pathway, the enzyme NAMPT converts nicotinamide and a phosphate-donor molecule into NMN. A second enzyme, NMNAT, then converts NMN into NAD+. Nicotinamide riboside can also enter this route after being converted to NMN by nicotinamide riboside kinases. Because NMN sits at a junction between precursor uptake and NAD+ formation, its cellular concentration is tightly linked to enzyme activity and tissue type. NAD+ participates in redox reactions, signaling, and DNA repair, and its levels decline with age in some animal models, though human evidence remains more limited and context-dependent.
Research interest in NMN increased after animal studies reported that oral or injected NMN can raise NAD+ levels in some tissues. How NMN is absorbed and distributed in humans is not fully established. Some evidence suggests extracellular NMN may be dephosphorylated to nicotinamide riboside before cellular uptake, while other studies propose specific transport routes. Direct human data on these mechanisms remain limited. Regulatory status also varies: in some countries NMN is treated as a dietary supplement, while elsewhere it is restricted or requires approval, and these differences affect labeling, sale, and research.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C11H15N2O8P | Neutral form; often supplied as a salt or hydrate. |
| Molecular weight | 334.22 g/mol | Calculated for C11H15N2O8P. |
| Appearance | White to off-white powder | Color can vary with purity and hydration. |
| Solubility | Soluble in water | Aqueous solutions are acidic and stability depends on pH and temperature. |
| Typical storage | −20 °C or below, desiccated | Protect from light; avoid repeated freeze-thaw cycles. |
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide base with a ribose sugar and a phosphate group. Within cells, NMN sits on the biosynthetic route that recycles nicotinamide back into nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in redox reactions and signaling, enzymes that produce and consume it influence many metabolic processes. The compound is therefore best described as an intermediate rather than a final signaling molecule.
In the canonical salvage pathway, nicotinamide phosphoribosyltransferase, known as NAMPT, transfers a phosphoribosyl group to nicotinamide and releases NMN. A second enzyme, NMN adenylyltransferase, then attaches an adenylyl group to NMN to form NAD+. Alternative routes exist, including a pathway that uses nicotinamide riboside and its phosphorylated forms. The relative contribution of extracellular NMN to intracellular NAD+ pools remains an area of active investigation, and the roles of specific transporters and enzymes are not completely defined.
Nicotinamide mononucleotide, usually shortened to NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide base linked to a ribose sugar that carries a phosphate group. In cells, NMN serves as an intermediate in the salvage pathway that produces nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in many oxidation-reduction reactions, NMN sits near central metabolic processes. The compound is not a drug in most jurisdictions and is discussed mainly in biochemistry and nutrition research.
The term NMN commonly refers to the beta isomer, in which the nicotinamide group is attached to the ribose through a beta-glycosidic bond. Commercial material may be supplied as the free acid or as a salt, such as a sodium salt, which affects molecular weight and water solubility. Related compounds include nicotinamide riboside and NAD+ itself, but these are distinct molecules with different formulas and cellular handling. Laboratory research often uses the beta form because it matches the naturally occurring configuration found in biological systems.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. The compound exists in cells as an intermediate in the production of nicotinamide adenine dinucleotide, a central redox cofactor. NMN is distinct from nicotinamide riboside, another related pyridine nucleotide, although the two compounds can converge in metabolic pathways. Its chemical formula is C11H15N2O8P, and it carries a net negative charge at physiological pH.
In the salvage pathway, NMN is generated from nicotinamide and 5-phosphoribosyl-1-pyrophosphate by the enzyme nicotinamide phosphoribosyltransferase. A second route produces NMN from nicotinamide riboside through phosphorylation by nicotinamide riboside kinases. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferases, often called NMNAT enzymes. This stepwise route allows cells to recycle nicotinamide and maintain NAD+ levels under changing metabolic conditions. The relative contribution of each route varies by tissue, species, and physiological state, and it remains an active area of research.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring with a ribose sugar and a phosphate group. The compound appears in cells across many organisms as an intermediate in the production of nicotinamide adenine dinucleotide, or NAD+. Because NMN sits close to NAD+ in metabolism, it has drawn interest in biochemistry and aging research. The molecule is not a dietary essential nutrient in the classical sense, and its presence in food is generally low and variable.
NAD+ serves as a coenzyme in redox reactions and as a substrate for enzymes involved in DNA repair and cellular signaling. In the salvage pathway, nicotinamide is converted to NMN by the enzyme NAMPT. NMN is then converted to NAD+ by NMNAT enzymes. A separate route links nicotinamide riboside to NMN through phosphorylation. These pathways maintain NAD+ levels, which can decline with age or metabolic stress in some tissues. The relative contribution of circulating NMN to tissue NAD+ remains an active area of study.
ACS first established technical divisions in 1908 to foster the exchange of information among scientists who work in particular fields of chemistry or professional interests. Divisional activities include organizing technical sessions at ACS meetings, publishing books and resources, administering awards and lectureships, and conducting other events. The original five divisions were 1) organic chemistry, 2) industrial chemists and chemical engineers, 3) agricultural and food chemistry, 4) fertilizer chemistry, and 5) physical and inorganic chemistry. As of 2016, there are 32 technical divisions of ACS.
Initial letters are used where there is no ambiguity: C cysteine, H histidine, I isoleucine, M methionine, S serine, V valine. No other amino acids in this set begin with each of those letters. Where arbitrary assignment is needed, the structurally simpler amino acids are given precedence: A alanine, G glycine, L leucine, P proline, T threonine. For example, alanine is simpler than arginine or asparagine, the other amino acids starting with "a". F PHenylalanine and R aRginine are assigned by being phonetically suggestive, W tryptophan is assigned based on the double ring being visually suggestive to the bulky letter W, K lysine and Y tyrosine are assigned as alphabetically nearest to their initials L and T (note that U was avoided for its similarity with V, while X was reserved for undetermined or atypical amino acids); for tyrosine the mnemonic tYrosine was also proposed, D aspartate was assigned arbitrarily, with the proposed mnemonic asparDic acid; E glutamate was assigned in alphabetical sequence being larger by merely one methylene –CH2– group, N asparagine was assigned arbitrarily, with the proposed mnemonic asparagiNe; Q glutamine was assigned in alphabetical sequence of those still available (note again that O was avoided due to similarity with D), with the proposed mnemonic Qlutamine.
6-carboxytetrahydropterin synthase (EC 4.1.2.50, CPH4 synthase, queD (gene), ToyB, ykvK (gene)) is an enzyme with systematic name 7,8-dihydroneopterin 3'-triphosphate acetaldehyde-lyase (6-carboxy-5,6,7,8-tetrahydropterin and triphosphate-forming). This enzyme catalyses the following reversible chemical reaction. 7,8-dihydroneopterin 3′-triphosphate + H2O ⇌ 6-carboxy-5,6,7,8-tetrahydropterin + acetaldehyde + triphosphate This enzyme binds Zn2+. It is isolated from the bacteria Bacillus subtilis and Escherichia coli. The stimulation is part of the biosynthesis pathway of queuosine. The enzyme from Escherichia coli can also convert 6-pyruvoyl-5,6,7,8-tetrahydropterin and sepiapterin to 6-carboxy-5,6,7,8-tetrahydropterin. Media related to 6-carboxytetrahydropterin synthase at Wikimedia Commons 6-carboxytetrahydropterin+synthase at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
Microscale manipulation and patterning of biological materials such as proteins, cells and tissues have been used in the development of cell-based arrays, microarrays, microfabrication based tissue engineering, and artificial organs. Biological micropatterning can be used for high-throughput single cell analysis, precise control of cellular microenvironment, as well as controlled integration of cells into appropriate multi-cellular architectures to recapitulate in vivo conditions. Photolithography, microcontact printing, selective microfluidic delivery, and self-assembled monolayers are some methods used to pattern biological molecules onto surfaces. Cell micropatterning can be done using microcontact patterning of extracellular matrix proteins, cellular electrophoresis, optical tweezer arrays, dielectrophoresis, and electrochemically active surfaces.
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It consists of nicotinamide, ribose, and phosphate groups.
No. NMN is a precursor, while NAD+ is the dinucleotide product formed after an adenylate group is added. They are distinct molecules with different cellular roles.
Small amounts of NMN have been reported in several foods, including some vegetables and meats. The concentrations are variable and usually much lower than those used in laboratory research.
Nicotinamide mononucleotide is a nucleotide intermediate in the biosynthesis of NAD+. It consists of nicotinamide attached to a ribose phosphate unit. NMN occurs naturally in cells and is present at low levels in some foods.